DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28a5 and cest-32

DIOPT Version :9

Sequence 1:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:332 Identity:57/332 - (17%)
Similarity:109/332 - (32%) Gaps:104/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DLDDIYRQYK----NKYDAVGIFGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDE----- 112
            |.:.:...||    :|:.....|..::...|...|            ||..:...|..||     
 Worm   267 DSESLLEWYKSQPLSKFQETATFEKKASGFLTFIP------------NFDGDFFPKPFDELSREA 319

  Fly   113 -KTDFIFANNPFSLTG--EKWKTRRADVTPGLTMGRIKTVY---PVTN--KVCQKLTEWVEKQLR 169
             |.|.:...:.:...|  ..:::||.|      |..||:.:   .|.|  .|.:::.|:..|.:.
 Worm   320 PKLDAMATVDEYEGLGFLTMFQSRRND------MDIIKSSFGSDVVENAVDVQKRIMEFYMKNID 378

  Fly   170 LGSKDGIDAKHMSLCFTTEMVTDCVLGLGAESFSDKPTPIMSK--------INDLFNQPWTFVLF 226
            ......::.:      ..::::|....:||.......|...|.        .|...|.|:.....
 Worm   379 KNDDKAVEKR------LIQLISDSWFNIGALETVKTSTKYGSNAYLGSFDYYNMGSNDPYATWFP 437

  Fly   227 FILTSSFPSLSHLI---KLRFVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFLDYILQLGE 288
            |...:....|.:::   ..:|.|::.|...:|:||:..               ::|:.|    |.
 Worm   438 FKAANHGSELKYMLGEGMGKFSPIEEEFKVIDMMGTLT---------------ANFVKY----GN 483

  Fly   289 KRNLDNRQL-------LAYSMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTI 346
            ...::..:|       ..||. |.:|                        ..:.|:|.:.|||.:
 Worm   484 PNGINGPELWKKYTPEKPYSY-FKID------------------------YPKSEMRDNFQDGRL 523

  Fly   347 -AFEKLS 352
             .||.::
 Worm   524 KLFEDIN 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 57/332 (17%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 51/316 (16%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.