DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and dkk1a

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:274 Identity:61/274 - (22%)
Similarity:89/274 - (32%) Gaps:73/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TAYRTVMRPSCCEGYEGSV--ENCKPVCRQQCPQHGFCSSPNTCSCNAGYGGIDC------HPVC 130
            |.|..|......:...|||  .:.:.:.....|.....:||...      |.:|.      |...
Zfish    12 TVYLAVWGGITVDAQVGSVLRNSIRHLPAASSPSDAVSASPRVT------GTVDSDAPPSPHCSA 70

  Fly   131 PTVCGKNEFCD-RPGVC-SCQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKC---ECE-PGYEK 189
            .:.|...|||: ..||| ||:...||              |.....|....:|   .|: .....
Zfish    71 DSECSIGEFCNGSRGVCLSCRKRRKR--------------CARDGMCCAGNRCINGVCQLADAAA 121

  Fly   190 VGNGTVFPDGYKNNSNGNCSPICPKDCGQNSRCVR--PGVCECENGYAGDDGGTNCRPVCSTCPE 252
            ||:....|.|...:.:|     .....|||....|  ..:.:.:....|.:|        .||..
Zfish   122 VGSADASPPGGNTDVSG-----VAVTRGQNFTHPRRTTVLSKPQQTQKGGEG--------ETCLR 173

  Fly   253 NGLCLSPGVC--------VCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQ-CECFPGY------ES 302
            :..||. |:|        :||| .:....:|..|..|   .||.:...| |:|..|.      |.
Zfish   174 SSDCLE-GLCCARHFWSRICKP-VLTEGQVCTRHRRK---GAHGLEIFQRCDCGSGLTCRGQREK 233

  Fly   303 SGADKK----CVPK 312
            .||:.:    |.|:
Zfish   234 PGAESRNLHTCQPR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 14/60 (23%)
COLIPASE 167..236 CDD:305210 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.