DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and dkk2

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001104679.1 Gene:dkk2 / 792404 ZFINID:ZDB-GENE-080204-14 Length:243 Species:Danio rerio


Alignment Length:162 Identity:37/162 - (22%)
Similarity:52/162 - (32%) Gaps:63/162 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 SGADKKCVPKCSKGCTNGF-CFAPETCVCSIG-YQMGPNQVCEPKCSLNCVHGKCTSPETCTCDP 365
            |||....:||.|.....|: |.:.:.||  :| |...|...  |...|:|...|........|.|
Zfish    50 SGASYSGIPKKSNIPAQGYPCSSDKECV--VGTYCHSPQHA--PSRRLSCRRRKKRCHRDNMCCP 110

  Fly   366 GYRFKD-----------NSH-------------------------------HECDP-ICDSGCSN 387
            |.|..:           :||                               ||.|| :..|.||.
Zfish   111 GNRCSNYICIPISESALSSHKSSMDENNKFSIKEKNWKKNGKAHAKISLKGHEGDPCLRSSDCSE 175

  Fly   388 GHCVAPNFCICHDGYQLNSTNPVTSMCQPICK 419
            |:|.|.:|.              |.:|:|:.:
Zfish   176 GYCCARHFW--------------TKICKPVLR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
dkk2NP_001104679.1 Dickkopf_N 70..120 CDD:282549 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.