DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and TNFAIP6

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens


Alignment Length:347 Identity:59/347 - (17%)
Similarity:93/347 - (26%) Gaps:143/347 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GTVFPDGYKNNSNGNCSPICPKDCGQNSRCVRPG-----------VCECENGYAGDDGGTNCRPV 246
            |..|.||..:||..     ..:..|...|..|.|           |||.|.|:            
Human    17 GWGFKDGIFHNSIW-----LERAAGVYHREARSGKYKLTYAEAKAVCEFEGGH------------ 64

  Fly   247 CSTCPENGLCLSPGVCVCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQCECFPGYESSGADKKCVP 311
            .:|..:.......|..||..|::.:..:..|..:                 ||           |
Human    65 LATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVK-----------------PG-----------P 101

  Fly   312 KCSKGCT---------------NGFCFAPETCVCSIGYQMGPNQVCEPKCSLNCVHGKCTSPETC 361
            .|..|.|               :.:|:.|....|.                     |..|.|:..
Human   102 NCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECG---------------------GVFTDPKQI 145

  Fly   362 TCDPGY--RFKDNSHHECDPIC-----------------------DSGCSNGHCVAPNFCICHDG 401
            ...||:  .::||.      ||                       |.||      ..::...:|.
Human   146 FKSPGFPNEYEDNQ------ICYWHIRLKYGQRIHLSFLDFDLEDDPGC------LADYVEIYDS 198

  Fly   402 YQLNSTNPVTSMCQPICKGCQFGDCVAPNVCEC-NVGYENINGLCELQTTTDSYEYSTTTVELQS 465
            |     :.|.......|     ||.:..::... ||  ..:..|.:...|...::.....::..|
Human   199 Y-----DDVHGFVGRYC-----GDELPDDIISTGNV--MTLKFLSDASVTAGGFQIKYVAMDPVS 251

  Fly   466 STVDPQLQTSTSEVPHSNCTAG 487
            .:...: .|||:...:.|..||
Human   252 KSSQGK-NTSTTSTGNKNFLAG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592 21/131 (16%)
CUB 135..244 CDD:278839 23/153 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.