DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and tnfaip6

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:187 Identity:44/187 - (23%)
Similarity:64/187 - (34%) Gaps:50/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ESVPYNRKVLKSKLVPFQQYSYFHGWVTKYRHQYVYEDETAYRTVMRPSCCEGYEGSVENCKPVC 99
            |:..|...:|.:.:...|....:|....|.|:|..|::..|        .|....|::.....: 
Zfish    26 EAWGYKNGILHNSIWLEQAAGVYHRESRKGRYQLTYKEAKA--------VCNFEGGTLATFDQL- 81

  Fly   100 RQQCPQHGF--CSSPNTCSCNAGYGGIDCHPVCPTV-CGKNEFCDRPGVCSCQNGYKRTSPSDN- 160
             :...|.||  |::........||         |.| .|.|  |....|.....|| |.:.|:. 
Zfish    82 -EAARQIGFHVCAAGWLDKGRVGY---------PIVKAGSN--CGFGKVGIIDYGY-RLNKSERW 133

  Fly   161 ---CLPVCEKECG--HHSFCSEPGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPIC 212
               |.....||||  |    ::|.|....|||         ||.|::..      ||
Zfish   134 DVYCYNPVAKECGGVH----TDPEKVLVSPGY---------PDEYQDEQ------IC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 24/113 (21%)
CUB 145..254 CDD:278839 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.