DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and Esm1

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_072126.1 Gene:Esm1 / 64536 RGDID:71013 Length:184 Species:Rattus norvegicus


Alignment Length:231 Identity:48/231 - (20%)
Similarity:63/231 - (27%) Gaps:110/231 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VLKSKLVPFQQYSYFH---GWVTKYRHQYVYEDETAYRTVMRPSCCEGYE-GSVENCKPVCRQQC 103
            :|.:.|:|      .|   .|..||             .|..|..|:..| .|...||......|
  Rat     6 LLTTLLIP------LHLGMAWSAKY-------------AVDCPEHCDNTECRSSLRCKRTVLDDC 51

  Fly   104 PQHGFCSSPNTCSCNAGYG-----------GIDCHP--VCPTVCGKNEFCDRPGVCSCQNGYKRT 155
               |.|.     .|.||.|           |:.|.|  .|.....:::|.|..|||         
  Rat    52 ---GCCQ-----VCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVC--------- 99

  Fly   156 SPSDNCLPVCEKECGHHSF---CSEPGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPICPKDCG 217
                       |:|.:.:|   |.|  .|.|:.|                        ||.:..|
  Rat   100 -----------KDCPYGTFGMDCKE--TCNCQSG------------------------ICDRVTG 127

  Fly   218 QNSRCV--------------RPGVCECENGYAGDDG 239
               ||:              |....:.|...|..||
  Rat   128 ---RCLDFPFFQYAAAKSPSRTSASQTERDAASGDG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
Esm1NP_072126.1 IGFBP 28..83 CDD:395164 16/62 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.