DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and ccbe1

DIOPT Version :10

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:245 Identity:50/245 - (20%)
Similarity:78/245 - (31%) Gaps:86/245 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLSFGTSFAILRHGLNDCSHPESVPYNRKVLKSKLVPFQQYSYFH--GWVTKYRHQYVYEDETAY 76
            |||...:..:...|.......|....:|:|.....:...:|....  |.||              
Zfish     9 SLSVAVALVLFSSGAPWTFREEKEDVDREVCSESKIATTKYPCVKSTGEVT-------------- 59

  Fly    77 RTVMRPSCCEGYEGSVENCKP---------VCRQQCPQHGFCSSPNTCSCNAGYGGIDCHPVCPT 132
             |..|..||||::..:..|.|         .|.|||..|              :|.:        
Zfish    60 -TCYRKKCCEGFKFVLGQCIPEDYDVCAGAPCEQQCTDH--------------FGRV-------- 101

  Fly   133 VCGKNEFCDRPGVCSCQNGYK------RTSPSDNCLPVCEKECGHHSFCSE-----PG--KCECE 184
                        ||:|.:||:      |......||.:.|....:.:.||:     ||  :|:|.
Zfish   102 ------------VCTCYDGYRYDRERHRNREKPYCLDIDECANNNETVCSQMCVNTPGSYRCDCH 154

  Fly   185 PGYEKVGNGTVFPDGYKNNSNGNCSPICPKDCGQNSRCVRPGVCE--CEN 232
            .|:       ...|..|..:.|..:|:..|    :...::.|.|.  ||:
Zfish   155 SGF-------YLEDDGKTCTKGERAPLFEK----SDNVMKEGTCSATCED 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:464251 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.