DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and NimC3

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:198 Identity:55/198 - (27%)
Similarity:80/198 - (40%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLHFVCLSLSFGTSFAILRHGLNDCSHPESVPYNRKVLKSKLV---------PFQQYSYFHGWVT 62
            ::|.|.:|     |.||..   ..|....||.|...|.|:::.         |....||      
  Fly    16 TIHLVEVS-----SLAITN---GHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSY------ 66

  Fly    63 KYRHQYVYEDETAYRTVMRPSCCEGYEGSVEN-CKPVCRQQCPQHGFCSSPNTCSCNAGY----- 121
                 .|||:...:..:.  .||.||...:.. |:|||::.||.|.:|:.|:.|.|..||     
  Fly    67 -----VVYEERVRWDNIQ--VCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHH 124

  Fly   122 ----GGIDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEK-ECGHHS-FCSEPGK 180
                ..:.|.|||...|.::..|.....|.|..|:|..|...:....||: :|||.. |  :||:
  Fly   125 HTTGHQLICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERVQCGHEQRF--DPGR 187

  Fly   181 CEC 183
            ..|
  Fly   188 RAC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
NimC3NP_524928.2 MSC 85..>212 CDD:286487 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.