DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and NimB3

DIOPT Version :10

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:49 Identity:22/49 - (44%)
Similarity:28/49 - (57%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 CFPGYESSGADK--KCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVC 342
            |..||.:.|..:  ||.|.||:.|:||.|.|||.|.|:.||... |:.|
  Fly    70 CCDGYVNKGTSQNLKCEPICSEDCSNGLCLAPEECECAPGYYRS-NKRC 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 17/35 (49%)

Return to query results.
Submit another query.