DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and NimC2

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster


Alignment Length:523 Identity:169/523 - (32%)
Similarity:227/523 - (43%) Gaps:111/523 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HQYVYEDETAYRTVMRPSCCEG---------------YEGSVENCKPVCRQQCPQHGFCSSPNTC 115
            |::|...:||...:....|..|               .:..::.|.|:|:..| .||.|.:||.|
  Fly   136 HRFVNGSQTACEPICVEDCANGRCLETGKCLCNNGYQRDEKLKKCVPICQDAC-YHGDCVAPNEC 199

  Fly   116 SCNAGYG---GID--CHPVCPTVCGKNEFCDRPGVCSCQNGY--KRTSPSDNCLPVCEKEC---- 169
            .|:.|:.   |:.  |.|:|.:.|. |.:|....||:|:.||  |..:.:..|.|||...|    
  Fly   200 RCHPGHEQRLGVPWICDPICSSGCA-NGYCQGAEVCACKMGYAHKDNTLASGCEPVCNPPCTNGT 263

  Fly   170 -----------GH-------------------HSFCSEPGKCECEPGYEKVGNGTVFPDGYKNNS 204
                       ||                   :.:||.||:|||..|:||             .|
  Fly   264 CISPGHCACSEGHVFAEGSRHECVPSCRSGCENGYCSSPGRCECHEGFEK-------------TS 315

  Fly   205 NGNCSPICPKDCGQNSRCVRPGVCECENGYAGDDGG-TNCRPVCSTCPENGLCLSPGVCVCKPGY 268
            ...|||.|...|||||||..|..|.|:.||...:|. |.|.|.|.....||:|.|||||.|..|:
  Fly   316 PHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRNCRNGICSSPGVCTCLEGF 380

  Fly   269 -VMRNDLCQPHCEKCSDNAHCVAPNQCECFPGYE---SSGADKKCVPKCSKGCTNGFCFAPETCV 329
             .:.:..|.|.|.|...:..|||||:|.||.||.   |.||: .|.|.||:||.:|||.|||.|.
  Fly   381 QALLSFYCIPVCSKTCIHGSCVAPNECRCFTGYRPNPSLGAN-VCEPICSQGCVHGFCIAPEICQ 444

  Fly   330 CSIGY-QMGPNQVCEPKCSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICDSGCSNGHCVAP 393
            |.:|: :......|||.|...||:..|.....|.|..||:.:..|...|||.|..||.||.||.|
  Fly   445 CDLGFIKRWATGTCEPHCPQKCVNSHCLGSGVCRCYEGYKLRPGSTSICDPECQPGCRNGTCVEP 509

  Fly   394 NFCICHDGYQLNSTNPVTSMCQPICK-GCQFGDCVAPNVCECNVGYENINGLCELQTTTDSYEYS 457
            |.|.|..||:   ...|...|.|.|: .|:.|.|.:|..|||:.|:          ..|:|.|.:
  Fly   510 NSCACFAGYE---DTKVPYECVPSCRPRCENGRCSSPGHCECDPGH----------VVTNSSEPN 561

  Fly   458 TTTVELQSSTVDPQLQTSTSEVPHSNCTA--GCMCWIEYDGMGTFNTAKCAKICVDPQDKPCLNL 520
            :...:.|...:            ::.|.|  .|.|...|..:...:| :|..||    .|.||:.
  Fly   562 SCRPQCQEQCI------------NAECVAPEKCACLPRYRFLPDSST-ECEPIC----SKGCLSG 609

  Fly   521 DNC 523
            ..|
  Fly   610 QEC 612



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I3394
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.