DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and NimB4

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:330 Identity:113/330 - (34%)
Similarity:144/330 - (43%) Gaps:37/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 CQNGYKRTSPS-DNCLPVCEKECGHHSFCSEPGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPI 211
            |..|::|.... ..|:|.|.:.|..:.||...|||.|            |.|...|..| ||.|.
  Fly   125 CCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVC------------FTDFVLNYRN-NCVPT 176

  Fly   212 CPKDCGQNSRCVRPGVCECENGYAGDDGGTNCRPVC-STCPENGLCLSPGVCVCKPGYV--MRND 273
            ||..| .:.||...|.|:|:.||..|.....|:|.| :||..|.:||.||.|.|..||.  :|..
  Fly   177 CPLGC-PHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRES 240

  Fly   274 L---CQPHCEKCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQ 335
            .   |||.|.......|||.||:||||||::.......|...|...|.||||....||||..||:
  Fly   241 AALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYR 305

  Fly   336 MGPN-QVCEPKCSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICDSGCS-NGHCVAPNFCIC 398
            ...| ..|.|.|..||.:|.|.||..|.|..||   ..:...|:.:|..||. .|.|:|||.|.|
  Fly   306 YDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGY---VRNRERCEAVCVGGCGFYGKCIAPNVCGC 367

  Fly   399 HDGYQLNSTNPVTSMCQPICKGCQFGDCVAPNVCECNVGYENINGLCELQTTTDSYEYSTTTVEL 463
                      .:....:...:.|::|.|.|...|.|.||.......|....|..:|. |...|::
  Fly   368 ----------AIVPGPERTYQRCEYGLCNAMGRCRCQVGMTRFIDRCMSPDTVTTYA-SMNPVKV 421

  Fly   464 QSSTV 468
            .:|.:
  Fly   422 NASLI 426



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4928
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.