DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and CG11674

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:335 Identity:69/335 - (20%)
Similarity:104/335 - (31%) Gaps:117/335 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GYKRTSPSDNCLPVCEKECGHHSFCS--EPGKC----------------ECEPGYEKVGNGTVFP 197
            |:..|..:::.|   |..|...:.|:  |.|:|                .|.|..|::       
  Fly    14 GFLATGRAEDLL---ELSCSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERL------- 68

  Fly   198 DGYKNNSNGNCSPICPKDCGQNSRC-VRPGVCECENGYAGDDGGTNCRPVCSTCPENGLCLSPGV 261
              ...|..|...| ||.   .|:.| .|...|.|..|:...|....|.|  :..|..|.|     
  Fly    69 --KLTNIIGGACP-CPM---PNAICHTRWQQCHCSEGHVSSDDRRRCLP--AVVPVGGSC----- 120

  Fly   262 CVCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTN----GFC 322
                        ..|..|::....:.|:. |||.|...:|..  :.:|:......|..    |.|
  Fly   121 ------------EFQQQCQRADRFSSCIG-NQCLCLNQFEFH--EGRCLSVLQSSCLEDKDCGSC 170

  Fly   323 FAPETCVCSIGYQMGPNQVCEPK-----CSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICD 382
            .|               .:|..|     ||.|.||    :.....|..|..:.|...|      .
  Fly   171 GA---------------SICLTKTKRCGCSKNFVH----NHNMTKCIKGSAYGDTCEH------S 210

  Fly   383 SGC-----SNGHCVAPNFCICHDGY---------------QLNSTNPVTSM-CQPICKGCQFGDC 426
            |.|     ::|.|: .:.|:|...:               .|::.|.:..: |.||   ..|| .
  Fly   211 SPCKLNLGADGRCL-DHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPI---VPFG-A 270

  Fly   427 VAPNVCECNV 436
            :..|..||.:
  Fly   271 LCRNDSECRM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.