DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and Dkk1

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:292 Identity:65/292 - (22%)
Similarity:93/292 - (31%) Gaps:90/292 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CSHP--------ESVPYNRKVLKSKLVPFQQYSYFHGWVTKYRHQYVYEDETAYRTVMRPSCCEG 87
            ||.|        .||..|...:|:...|........|.........:||....|:|         
  Rat    22 CSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQT--------- 77

  Fly    88 YEGSVENCKPV-CR--QQCPQHGFCSSPNTCSCNAGYGGIDCHPVCPTVCGKNEFCDRPGVCS-- 147
                ::|.:|. |.  ::|....:||||:..:  ||.||:.   :|.....:.:.|.|..:|.  
  Rat    78 ----LDNYQPYPCAEDEECGTDEYCSSPSRGA--AGVGGVQ---ICLACRKRRKRCMRHAMCCPG 133

  Fly   148 --CQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKCECEPG-YEKVGNGTVFPDGYKNNSNGNCS 209
              |:||.        |:|      ..||...   :.|.|.| .|.:||.....|||...:. ..|
  Rat   134 NYCKNGI--------CMP------SDHSHLP---RGEIEEGIIENLGNDHGAGDGYPRRTT-LTS 180

  Fly   210 PICPKDCGQNSRCVRPGVCECENGYAGDDGGTNCRPVCSTCPENGLCLSPGVC-------VCKPG 267
            .|......:.|.|:|...|                       ..|||     |       :||| 
  Rat   181 KIYHTKGQEGSVCLRSSDC-----------------------ATGLC-----CARHFWSKICKP- 216

  Fly   268 YVMRNDLCQPHCEKCSDNAHCVAPNQCECFPG 299
            .:....:|..|..|.|......  .:|.|..|
  Rat   217 VLKEGQVCTKHRRKGSHGLEIF--QRCYCGEG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.