DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and STAB1

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:398 Identity:99/398 - (24%)
Similarity:145/398 - (36%) Gaps:116/398 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILRHGLNDCSHPESVPYNRKVLKSKLVP-FQQYSYFHGWVTK--------YRHQYVYEDETAY-- 76
            :|..|.:.|.|..:     :.|:.|.|. .:::....|:..:        ||..:.:....:|  
Human  1252 VLTVGSSRCLHSHA-----EALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTC 1311

  Fly    77 -RTVMRPSCCEGYEGSV-ENCKPVCRQQCPQHGFCS----SPNTCSCNAGYGGIDCHPVCPTVCG 135
             :.:..|.||.|:.|:: |.|.......|..||.|.    ....|.|:.|:.|..|         
Human  1312 AKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTAC--------- 1367

  Fly   136 KNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSE----PGKCECEPGYEKVGNGTVF 196
              |.|:          ..|..|  ||..||  :|. |..|.|    .|.|.|..|::.:      
Human  1368 --EVCE----------LGRYGP--NCTGVC--DCA-HGLCQEGLQGDGSCVCNVGWQGL------ 1409

  Fly   197 PDGYKNNSNGNC-----SPICPKDCGQNSRCVR----PGVCECENGYAGDDGGTNCRPV--CS-- 248
                      .|     ||.||:.|..|:.||:    ...|.|..||:|:  |..|..|  |:  
Human  1410 ----------RCDQKITSPQCPRKCDPNANCVQDSAGASTCACAAGYSGN--GIFCSEVDPCAHG 1462

  Fly   249 --TCPENGLC--LSPG--VCVCKPGYVMRNDLCQP------HCEKCSDNAHCV--APNQ--CECF 297
              .|..:..|  ::||  .|.|:.||:...:|||.      |...|..:|.|:  .|.|  |.|.
Human  1463 HGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTGPQQVSCSCR 1527

  Fly   298 PGYESSGADKKC--VPKCSKGCTNGFCFAP-----------ETCVCSIGYQMGPNQVCEPKCSLN 349
            .||...|. :.|  :..|||  .||.| :|           .||.|...:.:|....|..:..|.
Human  1528 EGYSGDGI-RTCELLDPCSK--NNGGC-SPYATCKSTGDGQRTCTCDTAHTVGDGLTCRARVGLE 1588

  Fly   350 CVHGKCTS 357
            .:..|..|
Human  1589 LLRDKHAS 1596



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.