DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and DKK1

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:296 Identity:63/296 - (21%)
Similarity:87/296 - (29%) Gaps:99/296 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 AGYGGIDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKCEC 183
            |..||   ||:.             ||.:..|....::...|..|......||      ||..  
Human    19 AALGG---HPLL-------------GVSATLNSVLNSNAIKNLPPPLGGAAGH------PGSA-- 59

  Fly   184 EPGYEKVGNGTVFPDGYKNNSNGNCSPI-CPKD--CGQNSRCVRPGVCECENGYAGDDGGTNCRP 245
                .....|.::|.|.|..:..|..|. |.:|  ||.:..|..|        ..|.|.|..   
Human    60 ----VSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASP--------TRGGDAGVQ--- 109

  Fly   246 VCSTC-PENGLCLSPGVCVCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQCECFPG------YESS 303
            :|..| .....|:...:| | ||...:|.:|     ..||..|         |.|      .||.
Human   110 ICLACRKRRKRCMRHAMC-C-PGNYCKNGIC-----VSSDQNH---------FRGEIEETITESF 158

  Fly   304 GADKKCVPKCS------------KGCTNGFCFAPETCV----CSIGYQMGPNQVCEPKCSLNCVH 352
            |.|...:...|            ||.....|.....|.    |:..:.   :::|:|......| 
Human   159 GNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFW---SKICKPVLKEGQV- 219

  Fly   353 GKCTSP-----------ETCTCDPGYRFK-DNSHHE 376
              ||..           :.|.|..|...: ...||:
Human   220 --CTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 18/71 (25%)
DKK-type Cys-1 85..138 17/65 (26%)
DKK-type Cys-2 189..263 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.