DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_033424.1 Gene:Tnfaip6 / 21930 MGIID:1195266 Length:275 Species:Mus musculus


Alignment Length:168 Identity:37/168 - (22%)
Similarity:57/168 - (33%) Gaps:47/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HGWVTK--YRHQYVYEDETA--YRTVMRPSCCEGYEGSVENCKPVCR------------QQCPQH 106
            |||..|  ..|..::.::.|  |.   |.:....|:.:....|.||.            :...:.
Mouse    16 HGWGFKNGIFHNSIWLEQAAGVYH---REARAGRYKLTYAEAKAVCEFEGGRLATYKQLEAARKI 77

  Fly   107 GF--CSSPNTCSCNAGYGGIDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSDN----CLPVC 165
            ||  |::........||..:...|.|.  .||....|. |:        |.:.|:.    |....
Mouse    78 GFHVCAAGWMAKGRVGYPIVKPGPNCG--FGKTGIIDY-GI--------RLNRSERWDAYCYNPH 131

  Fly   166 EKECGHHSFCSEPGKCECEPGYEKVGNGTVFPDGYKNN 203
            .||||  ...::|.:....||         ||:.|.:|
Mouse   132 AKECG--GVFTDPKRIFKSPG---------FPNEYDDN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
Tnfaip6NP_033424.1 Link_domain_TSG_6_like 36..128 CDD:239592 19/105 (18%)
CUB 135..244 CDD:278839 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..275
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.