DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and dsl-5

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_502191.1 Gene:dsl-5 / 186492 WormBaseID:WBGene00001107 Length:302 Species:Caenorhabditis elegans


Alignment Length:196 Identity:51/196 - (26%)
Similarity:63/196 - (32%) Gaps:58/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CNAGYGGIDCHPVC----PTVCGKNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSE 177
            ||..:.|..|...|    .|..||:  |:..|..||.||...:.        |||       ...
 Worm   138 CNKNWFGEKCETFCDENKATNSGKH--CNFQGKPSCLNGLTGSK--------CEK-------LIV 185

  Fly   178 PGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPICPKDCGQNSRCVRPGVCE-------CENGYA 235
            |..|.||       ||.|..|       .|..|||  :|   |:..|...||       ..:.|.
 Worm   186 PKLCNCE-------NGGVCID-------SNPKPIC--EC---SKAYRGEKCEKKHISASLSSHYK 231

  Fly   236 GDDGG---TNCRPVCSTCPENGLCLSPGVCVCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQCECF 297
            ||...   |..:.:.|...||.|.   .:...:....:.|.|     ...||......||..|.|
 Worm   232 GDFWNFRMTFWQLIFSNLVENELA---EISKSEAWETINNLL-----GNVSDTPFANRPNNTETF 288

  Fly   298 P 298
            |
 Worm   289 P 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
dsl-5NP_502191.1 DSL <131..180 CDD:279722 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.