DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and Tnfrsf11b

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_036015123.1 Gene:Tnfrsf11b / 18383 MGIID:109587 Length:419 Species:Mus musculus


Alignment Length:242 Identity:59/242 - (24%)
Similarity:90/242 - (37%) Gaps:71/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVPYNRKVLK-------------SKLVPFQQYSYFHGWVTKYRHQYVYEDETAYRTVMRPSCCEG 87
            |..||:|:..             |||:...:::.......||.|   |:.||.:: ::...|..|
Mouse     5 SQDYNKKIQSSEAKIQAGVRFKLSKLLDIIEWTTQETLPPKYLH---YDPETGHQ-LLCDKCAPG 65

  Fly    88 -YEGSVENC----KPVCRQQCPQHGFCSSPNTC-SCNAGYGGIDCHPVCPTVCGKNEFCDRP--G 144
             |  ..::|    |.:| ..||.|.:..|.:|. .|      :.|.|||..:....:.|:|.  .
Mouse    66 TY--LKQHCTVRRKTLC-VPCPDHSYTDSWHTSDEC------VYCSPVCKELQSVKQECNRTHNR 121

  Fly   145 VCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKCECEPGYEKVGNGT--------VFPDGYK 201
            ||.|:.|  |....:.||.       |.|         |.||...|..||        ..|||:.
Mouse   122 VCECEEG--RYLEIEFCLK-------HRS---------CPPGSGVVQAGTPERNTVCKKCPDGFF 168

  Fly   202 NNSNGNCSPICPKDCGQNSRCVRPGVCECENGYAGDDGGTNCRPVCS 248
            :....:.:|     |.:::.|...|:...:.|.|..|.      |||
Mouse   169 SGETSSKAP-----CIKHTNCSTFGLLLIQKGNATHDN------VCS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
Tnfrsf11bXP_036015123.1 TNFRSF11B 30..169 CDD:276907 43/169 (25%)
CRD2 83..123 CDD:276907 12/45 (27%)
TNFRSF 140..>203 CDD:276900 17/82 (21%)
CRD2 163..203 CDD:276900 10/50 (20%)
Death <316..383 CDD:395422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.