Sequence 1: | NP_001260453.1 | Gene: | NimC1 / 34816 | FlyBaseID: | FBgn0259896 | Length: | 622 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503877.1 | Gene: | lag-2 / 178755 | WormBaseID: | WBGene00002246 | Length: | 402 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 54/200 - (27%) |
---|---|---|---|
Similarity: | 69/200 - (34%) | Gaps: | 71/200 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 292 NQCECF-PGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVCEPKCSLNCVHGKC 355
Fly 356 TSPETCTCDPGYRFKDNSHHECDPICDSGCSNGHCVAPN--------FCICHDGY---------- 402
Fly 403 -QLNSTNPVTSMCQPICKGCQFGDCVAPN----VCECNVGYENINGLCELQTTTDSYEYSTTTVE 462
Fly 463 LQSST 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimC1 | NP_001260453.1 | None | |||
lag-2 | NP_503877.1 | DSL | 103..166 | CDD:128366 | 14/58 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |