DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and lag-2

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_503877.1 Gene:lag-2 / 178755 WormBaseID:WBGene00002246 Length:402 Species:Caenorhabditis elegans


Alignment Length:200 Identity:54/200 - (27%)
Similarity:69/200 - (34%) Gaps:71/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 NQCECF-PGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVCEPKCSLNCVHGKC 355
            |:||.| ..:.:..|.|:             |.|.....|.||: |||          :|  |:.
 Worm   131 NRCENFCDAHLAKAARKR-------------CDAMGRLRCDIGW-MGP----------HC--GQA 169

  Fly   356 TSPETCTCDPGYRFKDNSHHECDPICDSGCSNGHCVAPN--------FCICHDGY---------- 402
            ..|..|:|            |.|.||.|  |..|...||        .|.|.:|:          
 Worm   170 VDPRKCSC------------ENDGICVS--SMIHPSQPNQTSSNEQLICECTNGFTGTRCEIFGF 220

  Fly   403 -QLNSTNPVTSMCQPICKGCQFGDCVAPN----VCECNVGYENINGLCELQTTTDSYEYSTTTVE 462
             |...|.|....|. :...|..|....||    .|.|.||:  |...||:..||.    :.||||
 Worm   221 NQFQLTAPRPDACS-VKDACLNGAKCFPNGPKVFCSCAVGF--IGEFCEISLTTT----TPTTVE 278

  Fly   463 LQSST 467
            :..||
 Worm   279 ITVST 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
lag-2NP_503877.1 DSL 103..166 CDD:128366 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.