DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and cpg-24

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_741322.2 Gene:cpg-24 / 176973 WormBaseID:WBGene00021525 Length:201 Species:Caenorhabditis elegans


Alignment Length:192 Identity:38/192 - (19%)
Similarity:62/192 - (32%) Gaps:77/192 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 INGLCELQTTTDSYEYSTTTVELQSSTV---DPQLQTSTSEVPHSNCTAGCMCWIEY-------- 494
            |..|.:|.:|:...:....:...||:|:   |.||.|....:|           |:.        
 Worm     7 IFSLFQLASTSGLLDIHLKSAHDQSATLTLTDEQLDTEYLRLP-----------IKISKNEEFKF 60

  Fly   495 -DGMGTFNTAKCAKICVDPQDKPCLNLDNCQCDLSSGQLVCQEDSDMDYSGENSRYVCHILPEQG 558
             |.:..|||....||.::  :.|.|.|                 ::..|:|.       :.|.:|
 Worm    61 EDILVDFNTTYSVKIILN--ETPKLGL-----------------AESIYTGT-------VNPARG 99

  Fly   559 ARSEAEVRIPDRTGSSNKWMIIVGSCAGMIIGVAATIIGIKYYRRSTSRRNFEAEEAIVECD 620
            |.|...:.:| .||     |:....|                      :.|:..|:..|.||
 Worm   100 ASSPETLNLP-LTG-----MMFEFKC----------------------QENWTGEKCDVRCD 133



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.