DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and CCBE1

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_016881045.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens


Alignment Length:333 Identity:77/333 - (23%)
Similarity:110/333 - (33%) Gaps:107/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 EKCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVCEP 344
            |.||::.  :|..:   :|..:|||....|.   .|.|..|:.|....|:.. .|.:.....||.
Human    45 EICSESK--IATTK---YPCLKSSGELTTCY---RKKCCKGYKFVLGQCIPE-DYDVCAEAPCEQ 100

  Fly   345 KCSLNCVHGKCTSPETCTCDPGYRFKDNSHHE-----CDPICDSGCSNGHCVAPNFCI------- 397
            :|:.|  .|:.    .|||.||||:....|.:     |..|.:...|||...| :.||       
Human   101 QCTDN--FGRV----LCTCYPGYRYDRERHRKREKPYCLDIDECASSNGTLCA-HICINTLGSYR 158

  Fly   398 --CHDGYQLNSTNPVTSMCQPICKGCQFGDCVAPNVCECNVGYENIN-----GLCELQTTTDSYE 455
              |.:||......          |.|..|| ..||    :.|:|...     |.| ..|..:.|:
Human   159 CECREGYIREDDG----------KTCTRGD-KYPN----DTGHEKSENMVKAGTC-CATCKEFYQ 207

  Fly   456 YSTTTVELQSS---------------TVDPQLQTST----------SEVPHSNCTAGCMCWIEYD 495
            ...|.::|:..               |.|..|.::|          .:.|...|           
Human   208 MKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGEC----------- 261

  Fly   496 GMGTFNTAKCAKICVDPQDKPCLNLDNCQCDLSSGQLVCQEDSDMDYSGENSRY-----VCHIL- 554
            |.|........|..  |:...|..|||          |.|..|..:.:.::.|.     ||..| 
Human   262 GRGHRRVITNRKSL--PKAHICWGLDN----------VLQLPSRRNKAHQDQREAQASPVCQALL 314

  Fly   555 --PEQGAR 560
              |..||:
Human   315 GSPAHGAQ 322



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.