DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and dkk3b

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001083014.1 Gene:dkk3b / 100038765 ZFINID:ZDB-GENE-061207-74 Length:283 Species:Danio rerio


Alignment Length:241 Identity:50/241 - (20%)
Similarity:65/241 - (26%) Gaps:118/241 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 EKCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVCEP 344
            |.|.|.:.|:          ||.  ...|||| |.  .||..|.....| |  |.|:        
Zfish   141 EDCGDGSFCL----------YEI--VTSKCVP-CQ--TTNMECTKDVEC-C--GDQL-------- 179

  Fly   345 KCSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICDSGCSNGHCVAPNFCICHDGYQLNSTNP 409
                 ||.|.|...:|         |..|...|..  .:.||..||     |..|          
Zfish   180 -----CVWGVCAQNKT---------KGQSGTICQN--QNDCSPQHC-----CAFH---------- 213

  Fly   410 VTSMCQPICK-------GCQFGDCVAPNVCECNVGYENINGLCELQTTTDSYEYSTTTVELQSST 467
             .::..|:|:       ||:                ...|.|.|:....|               
Zfish   214 -KALLFPVCRPKPQEGQGCE----------------REGNQLMEVLLWED--------------- 246

  Fly   468 VDPQLQTSTSEVP--HSNCTAGCMCWIEYDGMGTFNTAKCAKICVD 511
                      |.|  |..|.||.:|          ...:.:.:|||
Zfish   247 ----------EGPREHCPCAAGLLC----------QQIQKSSVCVD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
dkk3bNP_001083014.1 Dickkopf_N 137..186 CDD:282549 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.