DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC1 and tnfrsf1b

DIOPT Version :9

Sequence 1:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_005155971.1 Gene:tnfrsf1b / 100037357 ZFINID:ZDB-GENE-070410-133 Length:426 Species:Danio rerio


Alignment Length:201 Identity:54/201 - (26%)
Similarity:68/201 - (33%) Gaps:64/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 KNNSNGNCSPICPKDCGQ-NSRCVRPG-------------VCE-CENGYAGDDGGTNCRPVCSTC 250
            |...|...|....|..|. .||| :||             :|| |.:|...::  .|..|.|..|
Zfish    32 KEQCNNTTSEYYMKQLGLCCSRC-KPGTRLSVQCSTASDTICEPCPDGMYSEN--MNHYPNCFKC 93

  Fly   251 P----ENGLCL-------SPGVCVCKPGYVMRNDLCQPHCEKCSDNAHCVAPNQCE----CFPGY 300
            |    |.||..       :..|||||||.         :|.|...::.|   .:|:    |.|| 
Zfish    94 PTCREEKGLMYGRNCSADTKAVCVCKPGM---------YCSKYGLSSAC---EECKKYKTCKPG- 145

  Fly   301 ESSGADKKCVP----KCSKGCTNGFC--FAPETCVCSIGYQMGPNQVCEPKCSLNCVHGKCTSPE 359
              .||.:|..|    ||:...|..|.  ...|.|        .|:..||....|.  .|..|...
Zfish   146 --EGAQRKGTPTGVVKCAPCPTGTFSDRSGSEPC--------RPHTECEGSAVLR--SGNSTDDT 198

  Fly   360 TCTCDP 365
            .|...|
Zfish   199 VCVVKP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC1NP_001260453.1 None
tnfrsf1bXP_005155971.1 TNFRSF1B_teleost 31..160 CDD:276931 40/145 (28%)
CRD1 35..72 CDD:276931 9/37 (24%)
CRD2 75..116 CDD:276931 10/42 (24%)
CRD3 118..160 CDD:276931 15/56 (27%)
TNFRSF 141..>200 CDD:304602 19/71 (27%)
CRD2 163..200 CDD:276900 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.