DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and SCARF1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_003684.2 Gene:SCARF1 / 8578 HGNCID:16820 Length:830 Species:Homo sapiens


Alignment Length:311 Identity:74/311 - (23%)
Similarity:100/311 - (32%) Gaps:102/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ELQPKRREYLIRSH---ETQSDRGQHKCRIWVPPD---TVEKYSYPSVIQTDQANRLSLIEVC-- 130
            ||.||.:...:.|.   |.|.      |..|...|   |:.....|...|.|        |||  
Human    21 ELDPKGQHVCVASSPSAELQC------CAGWRQKDQECTIPICEGPDACQKD--------EVCVK 71

  Fly   131 --------------CTGYSASRLMGVTVCRAQCGCQ-NGSCK-IPGECECYDGFVRND--NGDCV 177
                          |:.....:..|.. ||..|.|. :|.|: ..|.|:|     :.|  ...|.
Human    72 PGLCRCKPGFFGAHCSSRCPGQYWGPD-CRESCPCHPHGQCEPATGACQC-----QADRWGARCE 130

  Fly   178 FACPLGCQNGQC-YLDGSCQCDPGYKLDETRRFCR--------------PICSSG---------- 217
            |.|..| .:|:| ...|.|.|:||:.....||.|:              .:|..|          
Human   131 FPCACG-PHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRC 194

  Fly   218 -CGSSPRHNCTEPE-ICGCSKGYQLTDDGCQPVCEPDCGIGGLCKDNNQCDCAPGYNLRDGVCQ- 279
             |..||   |.:.. .|.|..|:...:  ||..||  |..|.....:.:|.|.||:  |...|: 
Human   195 NCHGSP---CEQDSGRCACRPGWWGPE--CQQQCE--CVRGRCSAASGECTCPPGF--RGARCEL 250

  Fly   280 --------ADCYQKCNNGVCVSRNRC--------LCDPGYTYHEQSTMCVP 314
                    ..|...|  |.|.....|        .|:||:...:....|:|
Human   251 PCPAGSHGVQCAHSC--GRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
SCARF1NP_003684.2 CSRNP_N <100..135 CDD:292638 12/39 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.