DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and MEGF10

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016865476.1 Gene:MEGF10 / 84466 HGNCID:29634 Length:1195 Species:Homo sapiens


Alignment Length:270 Identity:69/270 - (25%)
Similarity:90/270 - (33%) Gaps:116/270 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CRAQCGCQNGS-CK-IPGECECYDGF------VRNDNGDCVFACPLGCQ---NGQC-YLDGSCQC 197
            |.::|||:|.: |. :.|.|.|..|:      :|..:|...|.|.|.||   .|.| .|||:|.|
Human   507 CSSRCGCKNDAVCSPVDGSCTCKAGWHGVDCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTC 571

  Fly   198 DPGYKLDETRRFCRPICSSGCGSSPRHNCTEPEICGCSKGYQLTDDGCQP--------------- 247
            .||::.::    |...|..|....   ||.|.  |.||..     |||.|               
Human   572 APGWRGEK----CELPCQDGTYGL---NCAER--CDCSHA-----DGCHPTTGHCRCLPGWSGVH 622

  Fly   248 ---VCE-----PDCGIGGLCK-------DNNQCDCAPGYNLRDGVCQA---------DCYQKC-- 286
               ||.     |:|.:...||       |:..|:||||:  |...||.         .|.|.|  
Human   623 CDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICECAPGF--RGTTCQRICSPGFYGHRCSQTCPQ 685

  Fly   287 ----------------------------------------------NNGVCVSRNR-CLCDPGYT 304
                                                          |||.|...:| |.|.||:.
Human   686 CVHSSGPCHHITGLCDCLPGFTGALCNEVCPSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWI 750

  Fly   305 YHEQSTMCVP 314
            ..:.|..|.|
Human   751 GSDCSQPCPP 760



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.