DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Pear1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 / 73182 MGIID:1920432 Length:1034 Species:Mus musculus


Alignment Length:403 Identity:96/403 - (23%)
Similarity:129/403 - (32%) Gaps:175/403 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SQDPGMGTYGRGYMENRQLSYNRPG---PAN-----FQDPRNVELQPKRREYLIRSHETQSDRGQ 95
            |.||.:.|:...:....:.|:.||.   ||.     ::||                         
Mouse    21 SNDPNVCTFWESFTTTTKESHLRPFSLLPAESCHRPWEDP------------------------- 60

  Fly    96 HKCRIWVPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCKIPG 160
            |.|   ..|..|.:..|..|::.|...||.    ||.||..||...|.:|..:  |.:|.|..|.
Mouse    61 HTC---AQPTVVYRTVYRQVVKMDSRPRLQ----CCRGYYESRGACVPLCAQE--CVHGRCVAPN 116

  Fly   161 ECECYDGFVRND------------------------------------NG----DCVFACPLG-- 183
            :|:|..|:...|                                    :|    :|:..||.|  
Mouse   117 QCQCAPGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSCDPKSGTCFCPSGLQPPNCLQPCPAGHY 181

  Fly   184 ---CQ-NGQCY------LDGSCQCDPGYKLDETRRFCRPICSSG-----------C--GSSP--- 222
               || :.|||      .||:|.|.||    .....|...||.|           |  |..|   
Mouse   182 GPACQFDCQCYGASCDPQDGACFCPPG----RAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGS 242

  Fly   223 RHNCTEPE-----ICG--CSKGYQLTDDGCQPVCEPDCGIGGLC-KDNNQCDCAPGYNLRDGVCQ 279
            :.:|:.|.     ||.  |.:|:.  ...|...|.  |..|||| :...||.||||| :.|. ||
Mouse   243 QGSCSCPPGWMGVICSLPCPEGFH--GPNCTQECR--CHNGGLCDRFTGQCHCAPGY-IGDR-CQ 301

  Fly   280 ---------ADCYQKCN----------NGVCV-----------------------SRNRCLCDPG 302
                     .||.:.|:          ||.|:                       .:..|.||| 
Mouse   302 EECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQEPCTCDP- 365

  Fly   303 YTYHEQSTMCVPV 315
                |.|..|.|:
Mouse   366 ----EHSLSCHPM 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Pear1NP_001027585.1 EMI 25..93 CDD:284877 20/99 (20%)
EGF_CA 535..580 CDD:304395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..1034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.