DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Megf11

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:286 Identity:73/286 - (25%)
Similarity:92/286 - (32%) Gaps:120/286 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EVCCTGYSASRLMGVTVCRAQCGCQN-GSCK-IPGECECYDGFVRNDNGDCVFACPLG------- 183
            |||....:|. ..|.. |.:.|.|.| |:|. :.|.|.|.:|:   ...||...||.|       
  Rat   431 EVCAVPCAAG-TYGPN-CSSVCSCSNGGTCSPVDGSCTCREGW---QGLDCSLPCPSGTWGLNCN 490

  Fly   184 ----CQNGQCY--LDGSCQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEPEICGCSKGYQLTD 242
                |.||...  .||||.|.||:..|.    |...|..|....   ||:|.  |.||..     
  Rat   491 ESCVCANGAACSPFDGSCACTPGWLGDS----CELPCPDGTFGL---NCSEH--CDCSHA----- 541

  Fly   243 DGCQPV--------------CE---------PDCGI------GGLCKD-NNQCDCAPGY------ 271
            |||.||              |:         |:|.:      ||.|.. :..|:||||:      
  Rat   542 DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPVDGSCECAPGFRGPLCQ 606

  Fly   272 --------------------------NLRDGVCQA--------------------DCYQKC---N 287
                                      :...|:|:.                    ||.|.|   |
  Rat   607 RICPPGFYGHGCAQPCPLCVHSRGPCHHVSGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCAN 671

  Fly   288 NGVCVS-RNRCLCDPGYTYHEQSTMC 312
            ||.|.. ...|.|.||:|..:.|..|
  Rat   672 NGTCSPIDGSCQCFPGWTGKDCSQAC 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Megf11XP_038938374.1 EMI 26..93 CDD:400092
EGF_CA 189..234 CDD:419698
Laminin_EGF 275..320 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.