DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Megf6

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus


Alignment Length:237 Identity:76/237 - (32%)
Similarity:92/237 - (38%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CCTGYSASRLMG-------VTVCRA-QCGCQNGSCKIPGE--CECYDGF-VRNDNGDC--VFACP 181
            |..||   :|.|       |..||| ..|||:.....||.  |||..|| :..|...|  :.:|.
  Rat   149 CPPGY---QLQGDGKTCQDVDECRAHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISSCT 210

  Fly   182 L---GCQNGQC----YLDGSCQCDPGYKLDETRRFC--RPICSSGCGSSPRHNCTEPE---ICGC 234
            |   |||: ||    .....|||.|.|:|.|..|.|  |..|:.|.|.. .|.|.|..   .|||
  Rat   211 LGNGGCQH-QCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCAEGNGGC-MHICQELRGLAHCGC 273

  Fly   235 SKGYQLTDDGCQPVCE--PDCGIG-GLCKD---NNQ----CDCAPGYNLRDGVCQADCYQ----- 284
            ..||||..|  :..||  .:|.:| ..|..   |.|    |.|..||.|  |.....||:     
  Rat   274 HPGYQLAAD--RKTCEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYEL--GADGRQCYRIEMEI 334

  Fly   285 ----KCNNGVC-------VSRNRCLCDPGYTYHEQSTMCVPV 315
                :..||.|       .:...|.|..||...|....|:.:
  Rat   335 VNSCEAGNGGCSHGCSHTSTGPLCTCPRGYELDEDQKTCIDI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Megf6NP_075244.1 EMI 42..112 CDD:284877
FXa_inhibition 127..162 CDD:291342 5/15 (33%)
vWFA <154..202 CDD:294047 17/47 (36%)
vWFA <237..285 CDD:294047 19/50 (38%)
vWFA <284..325 CDD:294047 13/42 (31%)
FXa_inhibition 338..373 CDD:291342 8/34 (24%)
vWFA <371..410 CDD:294047 1/6 (17%)
vWFA <413..452 CDD:294047
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.