DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Esm1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_072126.1 Gene:Esm1 / 64536 RGDID:71013 Length:184 Species:Rattus norvegicus


Alignment Length:132 Identity:36/132 - (27%)
Similarity:51/132 - (38%) Gaps:28/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CPLGCQNGQCYLDGSCQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEPEICGCSKGYQLTDDG 244
            ||..|.|.:|  ..|.:|.... ||:..  |..:|::|.|.:.....:..:...|..|.:     
  Rat    28 CPEHCDNTEC--RSSLRCKRTV-LDDCG--CCQVCAAGPGETCYRTVSGMDGVKCGPGLK----- 82

  Fly   245 CQPVCEPDCGIG---GLCKDNNQCDCAPGYNLRDGVCQADCYQKCN--NGVCVS-RNRCLCDPGY 303
            |....|.| ..|   |:|||   |..        |....||.:.||  :|:|.. ..|||..|.:
  Rat    83 CHFYSEED-DFGDEFGVCKD---CPY--------GTFGMDCKETCNCQSGICDRVTGRCLDFPFF 135

  Fly   304 TY 305
            .|
  Rat   136 QY 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Esm1NP_072126.1 IGFBP 28..83 CDD:395164 15/64 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.