DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and pear1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 / 571812 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio


Alignment Length:252 Identity:78/252 - (30%)
Similarity:101/252 - (40%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCKIPGECECYDGFVRNDN 173
            |..|..|::.|...|..    ||.|:..||...|..|..:  |.:|.|..|..|:|..|: |.| 
Zfish    74 KTLYRQVVKMDYRRRYQ----CCPGFYESRNKCVPRCTKE--CVHGRCVAPDRCQCEMGW-RGD- 130

  Fly   174 GDCVFACP-----------LGCQN-GQC-YLDGSCQCDPGYKLDETRRFCRPIC----------- 214
             ||..:|.           ..||| |:| .|.|:|||..||    |.:.|...|           
Zfish   131 -DCSSSCDGQHWGPGCRRLCECQNGGECDVLTGNCQCPAGY----TGQHCHDPCPVKWFGQGCRQ 190

  Fly   215 SSGCGSSPRHNCTEPEICGCSKGYQLTDDGCQPVC-EP-------DCGIGGLCKDNNQCDCAPGY 271
            ...||:....|.|..| |.|.:|:  |...|:..| .|       .|..||:|:.|..|.|.||:
Zfish   191 ECQCGTGGICNQTTGE-CVCKQGF--TGTLCEESCPRPKRCAARCPCQNGGICQGNGVCLCPPGW 252

  Fly   272 ----------NLRDGV-CQADCYQKCNN-GVC-VSRNRCLCDPGYTYHEQSTMCVPV 315
                      ..|.|: |..||.  |:| |.| ..:.:|.||.|||....:..| ||
Zfish   253 MGPVCTERCPPGRFGINCSKDCL--CHNGGHCDQEKGQCQCDAGYTGERCNEEC-PV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
pear1XP_700533.4 EMI 29..96 CDD:284877 8/25 (32%)
Laminin_EGF 411..451 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.