DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and stab2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017210540.1 Gene:stab2 / 565194 ZFINID:ZDB-GENE-041210-336 Length:2543 Species:Danio rerio


Alignment Length:361 Identity:85/361 - (23%)
Similarity:123/361 - (34%) Gaps:146/361 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LQPKRREYLIRSHETQSDRGQHKCRIWVPPDT---VEKYSYPSVIQTDQANRLSLIEVCCTG--- 133
            |..:::::|...|  ..|:.....|..:..||   ..:..|.|.::|.|.:.||   |.|.|   
Zfish  1780 LSQEQKDFLYAMH--NRDKLSEYLRYHILRDTKLMASELIYASSLKTQQGSDLS---VACMGEEQ 1839

  Fly   134 -------------------YSASRLMGV----------------------TVCRAQCG-----CQ 152
                               ::...:.|:                      ..||: ||     |.
Zfish  1840 IGELYVNHKGCRIVKRYLDFNGGMIYGIECLLNPPSLGGRCDHRQTIDFTLACRS-CGSSIMDCP 1903

  Fly   153 NGS-------CKIP-------GECE-----------CYDGFVRNDNGDCVFACPLG----CQN-G 187
            .||       |.:|       .:|:           |..|:.   ..||: |||.|    |.| |
Zfish  1904 LGSKPVGEQECVLPDSVISRGSKCQSTCKVVVWKPKCCSGYY---GRDCL-ACPGGPQSPCSNHG 1964

  Fly   188 QCYLD----GSCQCDPGYKLDETRRFCR--------PICSSGCGSSPRHNCTE----PEICGCSK 236
            :|..|    |:|.||.|:    |...|.        |.|:: |..:...:|.|    ...|.|.:
Zfish  1965 KCDEDHLGNGTCTCDTGF----TGVACESCLDGHFGPDCNA-CNCTEHGSCDEGLQGTGSCFCEE 2024

  Fly   237 GYQLTDDGCQ------PVCEPDCGIGGLCKDNNQCDCAPGYNLRDGV--------------CQAD 281
            |:  |...|:      |||.|.|...|:|.:||.|.|.|.|. .||:              |..|
Zfish  2025 GW--TGPQCENKLADGPVCNPACHEKGVCMENNTCVCKPFYE-GDGITCTVANMCKYWNGGCSKD 2086

  Fly   282 --CYQKCNNGVCVSRNRCLCDPGYTYHEQSTMCVPV 315
              |.||   |..||   |.|..|::  ....:|.|:
Zfish  2087 AKCSQK---GEKVS---CACLQGFS--GDGFVCTPI 2114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
stab2XP_017210540.1 EGF_3 239..268 CDD:289699
Fasciclin 374..495 CDD:280607
Fasciclin 518..643 CDD:280607
EGF_3 824..855 CDD:289699
EGF_3 910..941 CDD:289699
Fasciclin 1000..1119 CDD:280607
Fasciclin 1135..1252 CDD:280607
EGF_3 1465..1501 CDD:289699
EGF_3 1550..1586 CDD:289699
Fasciclin 1616..1716 CDD:280607
Fasciclin 1742..1873 CDD:280607 17/97 (18%)
EGF_3 2076..2111 CDD:289699 11/42 (26%)
EGF_3 2117..2154 CDD:289699
Link_Domain 2188..2280 CDD:295393
FAS1 2345..2438 CDD:214719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.