DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and megf11

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:222 Identity:65/222 - (29%)
Similarity:90/222 - (40%) Gaps:66/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 CRAQCGCQNGS-C-KIPGECECYDGFVRNDNGDCVFACPLG-----------CQNG-QCY-LDGS 194
            |..:|.|:||. | .|.|:|:|..|:   ....|...||:|           |||| :|| ::|:
Zfish   277 CSKECSCRNGGLCDHITGQCQCMAGY---SGHRCQEECPVGTYGPQCTLHCDCQNGAKCYHINGA 338

  Fly   195 CQCDPGYKLDETR-RFCRP-----ICSS--GCGSSPRHNCTEPEI--CGCSKGYQLTDDGCQPVC 249
            |.||.|:|....: |||.|     ||..  .|.|:...:| .|..  |.|:.|:  |...|...|
Zfish   339 CLCDTGFKGHHCQDRFCPPGLYGLICDKYCPCNSTNTISC-HPLTGECSCTAGW--TGLYCNETC 400

  Fly   250 EP-----DCGIGGLCKDNNQCD-------CAPGYNLRDGVCQADCYQKCNNG--------VCVSR 294
            .|     .||:...|.:...|.       |||||.      ..||.|.|.:|        :|...
Zfish   401 PPGYYGEGCGVPCQCANGADCHSLTGACICAPGYT------GDDCSQTCPSGLFGTNCTSICHCH 459

  Fly   295 NR---------CLCDPGYTYHEQSTMC 312
            |:         |:|..|:...:.|.:|
Zfish   460 NQASCSPIDGSCICKEGWQGVDCSILC 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
megf11XP_009291879.1 EMI 32..98 CDD:311482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.