DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and megf6b

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_009304569.1 Gene:megf6b / 557764 ZFINID:ZDB-GENE-101112-3 Length:1589 Species:Danio rerio


Alignment Length:318 Identity:74/318 - (23%)
Similarity:97/318 - (30%) Gaps:129/318 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HETQSDRGQHKCRIWVPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQ-CG 150
            |...:.||.:.|:                               |...|...:.|.|....| ||
Zfish   202 HTCVNTRGSYHCQ-------------------------------CNAGSRLHVDGRTCIAVQSCG 235

  Fly   151 CQNGSC------KIPG--ECECYDGF-VRNDNGDCVFACPLGCQNG----QCYLDGS---CQCDP 199
            ..||.|      :..|  :|.|...: :..|...|....|...|||    .|:.||:   |:|.|
Zfish   236 VGNGGCEHFCVQQTAGHVQCRCRPDYRLDADGKHCTLVNPCAEQNGGCSQMCHRDGAQARCECHP 300

  Fly   200 GYKLDETRRFCRPI---------CSSGC------------------------------------- 218
            ||:|.|..:.|..|         |:.||                                     
Zfish   301 GYQLAEDGKTCEDIDECALGQTDCAHGCRNTRGSFMCVCSAAYELGVDGKQCYRIEMEIVNSCDH 365

  Fly   219 ---GSSPRHNC---TEPEICGCSKGYQLTDD--GCQPV---------CEPDCG--IGGLCKDNNQ 264
               |.|  |:|   |...:|.|::||||..|  .|..:         ||.||.  .||.     :
Zfish   366 DNGGCS--HHCEHSTAGPLCSCNEGYQLDHDHKTCVDINECVDGSSCCEHDCTNYPGGY-----E 423

  Fly   265 CDCAPGYNLRDGVCQADCYQKC--NNGVC-------VSRNRCLCDPGYTYHEQSTMCV 313
            |.|..||.|....|..|...:|  .||.|       ....:|.|..||...|....|:
Zfish   424 CYCTAGYRLNTDGCSCDDIDECLAVNGGCDHACLNSAGSFQCSCRRGYRLDEDRRSCI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
megf6bXP_009304569.1 EMI 33..102 CDD:284877
FXa_inhibition 152..187 CDD:291342
vWFA <184..227 CDD:294047 7/55 (13%)
FXa_inhibition 234..270 CDD:291342 9/35 (26%)
FXa_inhibition 276..311 CDD:291342 13/34 (38%)
vWFA <308..350 CDD:294047 5/41 (12%)
FXa_inhibition 363..398 CDD:291342 12/36 (33%)
vWFA <396..436 CDD:294047 12/44 (27%)
FXa_inhibition 445..480 CDD:291342 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.