DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimC3

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:114 Identity:36/114 - (31%)
Similarity:51/114 - (44%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 CDPGYKLDETRRFCRPICSSGCGSSPRHN-CTEPEICGCSKGYQLTDDG-------CQPVCEPDC 253
            |.|||: .....||.|:|...|   |.|: |.||:.|.|.:||:.:...       |:|||:..|
  Fly    81 CCPGYR-TILFGFCEPVCQEAC---PAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGC 141

  Fly   254 GIGGLCKDNNQCDCAPGYNLRDGVCQADCYQKCNNGVCVSRNRCLCDPG 302
            .....|..:|:|:|.||:  :|.........:|....|....|  .|||
  Fly   142 PEHSHCVAHNECECWPGF--KDASSWFSLSLRCERVQCGHEQR--FDPG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
NimC3NP_524928.2 MSC 85..>212 CDD:286487 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.