DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and dsl-7

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001023803.1 Gene:dsl-7 / 3565725 WormBaseID:WBGene00001109 Length:313 Species:Caenorhabditis elegans


Alignment Length:66 Identity:17/66 - (25%)
Similarity:25/66 - (37%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 CPLGCQNGQCYLD-----GSCQCDPGYK----LDETRRFCRPICS-----SGCGSSPRHNCTEPE 230
            ||:|.:..:|.::     |.|:|..|.|    .|.......|||.     .|.....:....||:
 Worm   154 CPIGVRGSKCDIELPIDSGICKCMNGGKCVNSFDSKLTADFPICECLNGFEGAACEKQMKIFEPK 218

  Fly   231 I 231
            |
 Worm   219 I 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
dsl-7NP_001023803.1 DSL 101..163 CDD:128366 3/8 (38%)
EGF_CA <176..209 CDD:238011 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.