DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimC2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster


Alignment Length:284 Identity:81/284 - (28%)
Similarity:100/284 - (35%) Gaps:88/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 PSVIQTDQANRLSLIEVCCTGY----------------SASRLMGVTVCRAQCG----------- 150
            |.|.:|.....|...:|||.||                ::.:.:...||  .||           
  Fly    48 PLVGRTRTETYLGFTDVCCDGYIRDENNECVPLCNDCGASGKCLLPNVC--LCGKGYVSRKDHGH 110

  Fly   151 --------CQNGSCKIPGECECYDG--FVRNDNGDCVFACPLGCQNGQCYLDGSCQCDPGYKLDE 205
                    |.||.|..|.||||..|  ||......|...|...|.||:|...|.|.|:.||:.||
  Fly   111 CEPECSESCVNGKCVAPDECECLAGHRFVNGSQTACEPICVEDCANGRCLETGKCLCNNGYQRDE 175

  Fly   206 TRR-----------------------------------FCRPICSSGCGSSPRHNCTEPEICGCS 235
            ..:                                   .|.|||||||.:.   .|...|:|.|.
  Fly   176 KLKKCVPICQDACYHGDCVAPNECRCHPGHEQRLGVPWICDPICSSGCANG---YCQGAEVCACK 237

  Fly   236 KGYQLTDD----GCQPVCEPDCGIGGLCKDNNQCDCAPGYNLRDG---VCQADCYQKCNNGVCVS 293
            .||...|:    ||:|||.|.| ..|.|.....|.|:.|:...:|   .|...|...|.||.|.|
  Fly   238 MGYAHKDNTLASGCEPVCNPPC-TNGTCISPGHCACSEGHVFAEGSRHECVPSCRSGCENGYCSS 301

  Fly   294 RNRCLCDPGY---TYHEQSTMCVP 314
            ..||.|..|:   :.|..|..|.|
  Fly   302 PGRCECHEGFEKTSPHRCSPTCRP 325



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.