DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimC1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster


Alignment Length:326 Identity:88/326 - (26%)
Similarity:112/326 - (34%) Gaps:125/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQ----------------------- 148
            |.||.:..|.:.:.|.|..:...||.||..|......|||.|                       
  Fly    61 VTKYRHQYVYEDETAYRTVMRPSCCEGYEGSVENCKPVCRQQCPQHGFCSSPNTCSCNAGYGGID 125

  Fly   149 --------------------CGCQNG----------------------SCKIPGECECY------ 165
                                |.||||                      .|..||:|||.      
  Fly   126 CHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKCECEPGYEKV 190

  Fly   166 -------DGFVRNDNGDCVFACPLGC-QNGQCYLDGSCQCDPGYKLDETRRFCRPICSSGCGSSP 222
                   ||:..|.||:|...||..| ||.:|...|.|:|:.||..|:....|||:||: |   |
  Fly   191 GNGTVFPDGYKNNSNGNCSPICPKDCGQNSRCVRPGVCECENGYAGDDGGTNCRPVCST-C---P 251

  Fly   223 RHN-CTEPEICGCSKGYQLTDDGCQPVCEPDCGIGGLCKDNNQCDCAPGYNLR------------ 274
            .:. |..|.:|.|..||.:.:|.|||.|| .|.....|...|||:|.|||...            
  Fly   252 ENGLCLSPGVCVCKPGYVMRNDLCQPHCE-KCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSK 315

  Fly   275 -----------------------DGVCQADCYQKCNNGVCVSRNRCLCDPGY-----TYHEQSTM 311
                                   :.||:..|...|.:|.|.|...|.|||||     ::||...:
  Fly   316 GCTNGFCFAPETCVCSIGYQMGPNQVCEPKCSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPI 380

  Fly   312 C 312
            |
  Fly   381 C 381



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.