DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimB4

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:256 Identity:105/256 - (41%)
Similarity:146/256 - (57%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 RREYLIRSHETQSDRGQH--KCRIWVPPDTVEKYSYPSVIQTDQAN-RLSLIEVCCTG-----YS 135
            |:.|:|.:..:...||:|  |||..||....:......::.....| .:::|||||.|     |.
  Fly    71 RKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYD 135

  Fly   136 ASRLMGVTVCRAQCG--CQ-NGSCKIPGECECYDGFVRNDNGDCVFACPLGCQNGQCYLDGSCQC 197
            .|:      |...||  || ||.|...|:|.|:..||.|...:||..|||||.:|:|||:|:|||
  Fly   136 WSQ------CVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQC 194

  Fly   198 DPGYKLDETRRFCRPICSSGCGSSPRHN--CTEPEICGCSKGYQ--LTDD---GCQPVCEPDCGI 255
            |.||:||.:|:||:|.|::.||    ||  |.||..|.|::||.  |.:.   ||||:|.||||.
  Fly   195 DKGYELDGSRKFCQPQCNATCG----HNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGY 255

  Fly   256 GGLCKDNNQCDCAPGYNLR-DGV-CQADCYQKCNNGVCVSRNRCLCDPGYTYHEQSTMCVP 314
            |. |...|:|:|.||:..| :|: |:.|||..|.||.|.::..|:|..||.|.:.:|.|:|
  Fly   256 GH-CVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTTTCLP 315



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469381
Domainoid 1 1.000 66 1.000 Domainoid score I9676
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 1 1.000 - - FOG0014295
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.