DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimA

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:291 Identity:66/291 - (22%)
Similarity:95/291 - (32%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IYTNVPSYSDRYNRRPVSQDPG-MGTYGRGYMENRQLSYNRPGPANFQDPRNVELQPKRREYLIR 85
            |.|||..........|..|.|| :......|:|:.|:.               |:||.|    :|
  Fly    30 INTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQVP---------------EMQPVR----VR 75

  Fly    86 SHETQSDRGQHKCRIW---VPPDTVE-KYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCR 146
            :..            |   :||.... |.....|::..:.|:...:..||.||..:.......|:
  Fly    76 TSS------------WCMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCK 128

  Fly   147 AQC--GCQNGSCKIPGECECYDGFVRNDNGDCVFACP-----LGCQNGQCYLDGSCQCDPGYKLD 204
            ..|  ||..|||.:|..|.|.:|::   ...|...|.     |.|:|       .|||..|...|
  Fly   129 PICRGGCGRGSCVMPDICSCEEGYI---GKHCTQRCDHDRWGLDCKN-------LCQCQNGAACD 183

  Fly   205 ETRRFCRPICSSGCGSSPRHNCTEPEICGCSKGYQLTDDGCQPVCEPDCGIGGLCKDNNQCDCAP 269
            .         .||             :|.|..|:  |...|:..| |....|.:|:....||..|
  Fly   184 N---------KSG-------------LCHCIAGW--TGQFCELPC-PQGTYGIMCRKACDCDEKP 223

  Fly   270 GYNLRDGVCQADCYQKCN--NGVCVSRNRCL 298
                            ||  .|.|:.:::.|
  Fly   224 ----------------CNPQTGACIQQDQPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 16/94 (17%)
EGF_2 170..200 CDD:285248 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.