DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Dlk2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017451911.1 Gene:Dlk2 / 316232 RGDID:1309143 Length:405 Species:Rattus norvegicus


Alignment Length:247 Identity:63/247 - (25%)
Similarity:87/247 - (35%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 HKC-RIW--VPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCK 157
            |:| .:|  :.|..:.    |.:........|:|:.:.|...:.|:......|.:.|...:|.|.
  Rat     4 HRCLHVWPFIRPSLLR----PELTMPSGCRCLNLVCLLCILGATSQPARADDCSSHCDLAHGCCA 64

  Fly   158 IPGECECYDGFVRNDNGDCVFACPLGCQNGQCYLDGSCQCDPGYKLDETRRFCRPICSSGCGSSP 222
            ..|.|.|..|:.......|| ..| |||:|.|:....|.|..|:    ..:||         ...
  Rat    65 PDGSCRCDPGWEGLHCERCV-RMP-GCQHGTCHQPWQCICHSGW----AGKFC---------DKD 114

  Fly   223 RHNCTEPEICGCSKGYQLTDDG-------CQP------------VCEP---DCGIGGLCKDNN-- 263
            .|.||...  .|..|.|...||       |.|            .||.   .|..||.|:||.  
  Rat   115 EHICTSQS--PCQNGGQCVYDGGGEYHCVCLPGFRGRGCERKAGPCEQAGFPCQNGGQCQDNQGF 177

  Fly   264 ----QCDCAPGYNLRDGVCQA---DCYQK-CNNG-VC---VSRNRCLCDPGY 303
                .|.|..|:  ....|:.   ||..: |.|| .|   ::|..|||..|:
  Rat   178 ALNFTCRCLAGF--MGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Dlk2XP_017451911.1 EGF_CA 112..152 CDD:238011 10/41 (24%)
EGF_CA <164..195 CDD:238011 9/32 (28%)
EGF_CA 197..233 CDD:238011 11/31 (35%)
EGF_CA 235..271 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.