DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and dkk1b

DIOPT Version :10

Sequence 1:NP_609692.3 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_571078.1 Gene:dkk1b / 30197 ZFINID:ZDB-GENE-990708-5 Length:241 Species:Danio rerio


Alignment Length:118 Identity:31/118 - (26%)
Similarity:40/118 - (33%) Gaps:27/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SGCGSSPRHNCTEPEICGCSKGYQLTDDGCQP-VCEPD--CGIGGLCKDNN----QCDCAPGYNL 273
            ||...|.......|::..........|...|| :||.|  ||....|..:.    ||.......:
Zfish    35 SGAAGSSHPVSPSPDVSPLDSLNFALDTPQQPLICESDEECGGEEFCFQSRGVCLQCKKRRKRCI 99

  Fly   274 RDGVCQADC-YQKCNNGVCVSRNRCLCDPGYTY-----------HEQSTMCVP 314
            ||.:|   | ...|:||||:..     ||....           ||.||..:|
Zfish   100 RDAMC---CPGNHCSNGVCIPN-----DPDIIQQLGMEEFVSIAHENSTALMP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_609692.3 None
dkk1bNP_571078.1 Dkk_Cys1 6..116 CDD:471087 23/83 (28%)
Dkk1_Cys2 158..239 CDD:437998
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.