DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Megf10

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001094127.1 Gene:Megf10 / 291445 RGDID:735084 Length:1145 Species:Rattus norvegicus


Alignment Length:316 Identity:77/316 - (24%)
Similarity:102/316 - (32%) Gaps:137/316 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EVCCTGYSASRLMGVTVCRAQCGCQNGS-C-KIPGECECYDGF---------------------- 168
            |.|..|:...      .|:..|.||||: | .:.|.|.|..||                      
  Rat   398 ETCSPGFYGE------ACQQICSCQNGADCDSVSGRCACAPGFKGTDCSTPCPLGRYGINCSSRC 456

  Fly   169 -VRND------NGDCV--------------------FACPLGCQ---NGQC-YLDGSCQCDPGYK 202
             .:||      :|.|:                    |.|.|.||   .|.| .|||:|.|.||::
  Rat   457 GCKNDAVCSPVDGSCICKAGWHGVDCSISCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWR 521

  Fly   203 LDETRRFC-----------RPICS--SGCGSSPRH-----------------------NCTEP-- 229
            .::....|           |..||  .||..:..|                       ||:.|  
  Rat   522 GEKCEFPCQDGTYGLNCAERCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCY 586

  Fly   230 -----------EICGCSKGYQLTDDGCQPVCEPD-----CG--------IGGLCKD-NNQCDCAP 269
                       .||.|:.|::.|.  ||.:|.|.     |.        ..|.|.. ...|||.|
  Rat   587 CKNGASCSPDDGICECAPGFRGTT--CQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLP 649

  Fly   270 GYN--LRDGVCQA-----DCYQKC---NNGVCVSRNR-CLCDPGYTYHEQSTMCVP 314
            |:.  |.:.||.:     :|...|   |||.|...:| |.|.||:...:.|..|.|
  Rat   650 GFTGALCNEVCPSGRFGKNCAGVCTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPP 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Megf10NP_001094127.1 EMI 32..99 CDD:400092
EGF_Lam 281..318 CDD:214543
EGF_CA 542..587 CDD:419698 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.