DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and NimB2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:289 Identity:90/289 - (31%)
Similarity:116/289 - (40%) Gaps:77/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 HETQSDRGQHKCRIWVPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCG- 150
            ::|:|......|...||..::.:.|....:.......:|.|:|||.||..:..: ...|...|. 
  Fly   124 NKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHI-YRRCEPICAD 187

  Fly   151 -CQNGSCKIPGECECYDGFVRNDNGDCVFACPLGCQNGQCYLDGSCQCDPGYKLD-ETRRFCRPI 213
             |:||.|..|..|.|..|.||...|.|:..|||||.||.|.....|:|..||.|: |||::|:|.
  Fly   188 DCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPE 252

  Fly   214 CSSGCGSSPRHNCTEPEICGCSKGYQLTDDG-CQPV---------------------------CE 250
            |..||...   .|..|..|.|..||:|..|| |:||                           ||
  Fly   253 CKPGCSFG---RCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGHCNCNAGYLKLQGRCE 314

  Fly   251 PDCGI-------------------------------------GGLCKDNNQCDCAPGYNLRD--- 275
            |.|.|                                     .|:|..||||||..|| :||   
  Fly   315 PICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTGY-VRDEHQ 378

  Fly   276 -GVCQADCYQKCNNGVCVSRNRCLCDPGY 303
             .:||..|.|.|.||.|.:.|.|:|.||:
  Fly   379 RNICQPHCPQGCQNGYCSAPNFCICRPGF 407



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.