DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Dkk4

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:175 Identity:38/175 - (21%)
Similarity:58/175 - (33%) Gaps:49/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 CTGYSASRLMGVTVCRAQCGCQNGSCKIPGE------CECYDG----FVRNDNGDCVFACPLGCQ 185
            |..:...|....|..|.:..||..:...||.      |...:.    ..||.:|          |
Mouse    53 CLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDG----------Q 107

  Fly   186 NGQCYLDGSCQCDPGYKLDETRRFCRPICSSGCGSSPR--HNCTEPEICG----CSKGYQLTDDG 244
            :| .|.:|:.:    :..:|.|...:|.......|..:  .:|.....||    |::.:      
Mouse   108 DG-AYAEGTTK----WPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHF------ 161

  Fly   245 CQPVCEPDCGIGGLC-----KDNNQ-------CDCAPGYNLRDGV 277
            ...:|:|....|.:|     ||..|       |||.||...|..|
Mouse   162 WTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 8/37 (22%)
DKK-type Cys-1 41..90 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 11/56 (20%)
DKK-type Cys-2 145..218 18/68 (26%)
Prokineticin <145..202 CDD:148298 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.