DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and STAB1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:268 Identity:67/268 - (25%)
Similarity:90/268 - (33%) Gaps:106/268 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CCTGYSAS-------RLMGVTVCRAQCGCQN---GSCKIPGECECYDGFVRNDNGDCVFACPLG- 183
            ||.|:..:       .|.|  ||.....||:   ||    |||.|::||    :|.....|.|| 
Human  1320 CCPGFFGTLCEPCPGGLGG--VCSGHGQCQDRFLGS----GECHCHEGF----HGTACEVCELGR 1374

  Fly   184 ----------CQNGQCYL----DGSCQCDPGYK-LDETRRFCRPICSSGCGSSPRHNCTE----P 229
                      |.:|.|..    ||||.|:.|:: |...::...|.|...|  .|..||.:    .
Human  1375 YGPNCTGVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKC--DPNANCVQDSAGA 1437

  Fly   230 EICGCSKGYQLTDDGCQPV---------CEP--DC-----------------GIGGLCKDNNQC- 265
            ..|.|:.||......|..|         |.|  :|                 |.|.||::.|.| 
Human  1438 STCACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCL 1502

  Fly   266 ----------DCAP------------GYNLRDGVCQADCYQKC--NNGVCV----------SRNR 296
                      :|.|            ||: .||:...:....|  |||.|.          .:..
Human  1503 IHHGGCHIHAECIPTGPQQVSCSCREGYS-GDGIRTCELLDPCSKNNGGCSPYATCKSTGDGQRT 1566

  Fly   297 CLCDPGYT 304
            |.||..:|
Human  1567 CTCDTAHT 1574



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.