DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Megf6

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001156449.1 Gene:Megf6 / 230971 MGIID:1919351 Length:1572 Species:Mus musculus


Alignment Length:300 Identity:82/300 - (27%)
Similarity:101/300 - (33%) Gaps:100/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 TVEKYSYPSVIQTDQANRLSLIEVCCTGYS-------------------------ASRLMGVTVC 145
            ||...||..|..|:...    :..||.|:|                         ....:|...|
Mouse    86 TVYYMSYRQVYATEART----VFRCCPGWSQKPGQEGCLSDVDECANANGGCEGPCCNTVGGFYC 146

  Fly   146 RA-----------------QCGCQNGSCK-----IPGE--CECYDGF-VRNDNGDC--VFACPL- 182
            |.                 :|...||.|:     .||.  |||..|| :..|...|  :.:|.| 
Mouse   147 RCPPGYQLQGDGKTCQDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISSCTLG 211

  Fly   183 --GCQNGQC----YLDGSCQCDPGYKLDETRRFC--RPICSSGCGSSPRHNCTEPE---ICGCSK 236
              |||: ||    .....|||.|.|:|.|..|.|  |..|:.|.|.. .|.|.|..   .|||..
Mouse   212 NGGCQH-QCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGC-MHTCQELRGLAHCGCHP 274

  Fly   237 GYQLTDD--GCQPVCEPDCGIG-GLCKD---NNQ----CDCAPGYNLRDGVCQADCYQ------- 284
            ||||..|  .|:.|.|  |.:| ..|..   |.|    |.|..||.|  |.....||:       
Mouse   275 GYQLAADRKACEDVDE--CALGLAQCAHGCLNTQGSFKCVCHAGYEL--GADGRQCYRIEMEIVN 335

  Fly   285 --KCNNGVC-------VSRNRCLCDPGYTYHEQSTMCVPV 315
              :..||.|       .:...|.|..||...|....|:.:
Mouse   336 SCEAGNGGCSHGCSHTSTGPLCTCPRGYELDEDQKTCIDI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Megf6NP_001156449.1 EMI 42..111 CDD:284877 9/28 (32%)
FXa_inhibition 126..161 CDD:291342 3/34 (9%)
vWFA <153..201 CDD:294047 12/47 (26%)
vWFA <236..284 CDD:294047 19/48 (40%)
vWFA <283..324 CDD:294047 14/44 (32%)
FXa_inhibition 337..372 CDD:291342 8/34 (24%)
vWFA <370..409 CDD:294047 1/5 (20%)
vWFA <412..451 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.