DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and Megf11

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_006511049.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus


Alignment Length:286 Identity:72/286 - (25%)
Similarity:92/286 - (32%) Gaps:120/286 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EVCCTGYSASRLMGVTVCRAQCGCQN-GSCK-IPGECECYDGFVRNDNGDCVFACPLG------- 183
            |||....:|. ..|.. |.:.|.|.| |:|. :.|.|.|.:|:   ...||...||.|       
Mouse   430 EVCAVPCAAG-TYGPN-CSSVCSCSNGGTCSPVDGSCTCREGW---QGLDCSLPCPSGTWGLNCN 489

  Fly   184 ----CQNGQCY--LDGSCQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEPEICGCSKGYQLTD 242
                |.||...  .||||.|.||:..|.    |...|..|....   ||:|.  |.||..     
Mouse   490 ETCICANGAACSPFDGSCACTPGWLGDS----CELPCPDGTFGL---NCSEH--CDCSHA----- 540

  Fly   243 DGCQPV--------------CE---------PDCGI------GGLCK-DNNQCDCAPGY------ 271
            |||.||              |:         |:|.:      ||.|. ::..|:||||:      
Mouse   541 DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQ 605

  Fly   272 --------------------------NLRDGVCQA--------------------DCYQKC---N 287
                                      :...|:|:.                    ||.|.|   |
Mouse   606 RICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCAN 670

  Fly   288 NGVCVS-RNRCLCDPGYTYHEQSTMC 312
            ||.|.. ...|.|.||:...:.|..|
Mouse   671 NGTCSPIDGSCQCFPGWIGKDCSQAC 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
Megf11XP_006511049.1 EMI 25..92 CDD:400092
EGF_CA 188..233 CDD:419698
EGF_CA 274..319 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.