DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and C53B7.2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:218 Identity:43/218 - (19%)
Similarity:71/218 - (32%) Gaps:87/218 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 YSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCKIPGECECYDGFVRNDNG 174
            :::|..:       ||::.|..:.|..      |..:..||                  :.....
 Worm     3 FAFPIAL-------LSVVLVVDSQYHQ------TTTQVSCG------------------INEQYS 36

  Fly   175 DCVFACPLGCQ--NGQCYLD---GSCQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEPEICGC 234
            .|...||..|:  |.||.:|   .||.|.||:....:|:         |  .|.::|.:.:...|
 Worm    37 PCTQMCPPTCESPNPQCRVDCTRPSCTCLPGHVYSNSRQ---------C--IPANSCYQTQSLRC 90

  Fly   235 SKGYQLTDDGCQPVCEPDCGIGGLCKDNNQCDCAPGYNLR----------------------DGV 277
                ::.:| |:|         |:...|..|..|.|...|                      .|.
 Worm    91 ----RMNND-CRP---------GMYCINGYCGAASGVYTRTVVSSSSLSSSSSGHRHHSHRSQGE 141

  Fly   278 CQADCY----QKCNNGVCVSRNR 296
            |..|.:    :.|.:|:||..:|
 Worm   142 CSLDVHCDHRKICIDGICVYADR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
C53B7.2NP_509154.2 TIL 29..82 CDD:366828 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.