DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and M03F4.6

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:264 Identity:68/264 - (25%)
Similarity:85/264 - (32%) Gaps:109/264 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TVCR---AQCG--CQNGSCKIP-----GECECYDGFVRNDNGDCVFACPLGCQ------------ 185
            |:||   |:.|  ||. .||.|     |:|||:.|.:  .:|.||..||:|.|            
 Worm    69 TICRLAPAKIGDSCQR-DCKPPLLCRDGKCECWGGSI--VDGKCVVLCPVGQQLYGVECTRVAHY 130

  Fly   186 ------NGQCY------LDGSCQCDPGYKLDETRRFCRPICSSGCGSSPRHNC------------ 226
                  :.||.      :.|:|.|.||...|..|.||...|..  |..||..|            
 Worm   131 QQPCEKDSQCVDPFNACIAGTCLCAPGTTRDTERGFCHATCPD--GMHPRQTCRRLFINDIDMLE 193

  Fly   227 TEPEICGCSKGYQLTDDG-------CQ---PVCEPD----CGIGGL------------------- 258
            .......|..||:....|       |:   |..|||    |..|..                   
 Worm   194 NAANTDSCPLGYRCVTYGSPYVGHCCRLRCPYGEPDLSQSCDAGASPDSKCRPLTHFCFTVSEPG 258

  Fly   259 ----------CKD------NNQCDCAPGYNLRDGVCQADCYQKCNNGVCVS--RNRCLCDPGYTY 305
                      |:|      |.||   .....|...||.|  |:|..|:.:|  ...|.|..|  |
 Worm   259 WKSSLCCPRPCRDPTPLYVNGQC---LSIAHRGDPCQID--QQCEGGITMSCTLGSCQCKLG--Y 316

  Fly   306 HEQS 309
            ||.:
 Worm   317 HENN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
M03F4.6NP_508843.1 EB 113..160 CDD:279949 11/46 (24%)
EB 272..321 CDD:279949 17/56 (30%)
EB 331..381 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.