DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and F56B3.2

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_499983.2 Gene:F56B3.2 / 176902 WormBaseID:WBGene00018928 Length:432 Species:Caenorhabditis elegans


Alignment Length:273 Identity:61/273 - (22%)
Similarity:85/273 - (31%) Gaps:115/273 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 CTGYSASRLMGVTVCRAQCGCQN-GSCKIPGECECYDGF--VRNDNG--------------DCVF 178
            |.|.||  |.|  ||.....|:| ||..:.|:|.|:..:  .|::.|              .|..
 Worm    28 CNGKSA--LNG--VCDINGDCENKGSICLRGKCRCHPHYTETRDEKGRLPKCAPLPAKIGARCSS 88

  Fly   179 AC--PLGCQNGQCYL---------DGSC--------QCDPGYKLDETRRFC-------------- 210
            .|  ||.|:||:|..         :|.|        :|...|........|              
 Worm    89 KCREPLFCRNGECQCVQRGTTRVSNGECITTSRVGDRCSRHYDCTSPFSACVNSQCVCITGTIQM 153

  Fly   211 --RPICSSGC--GSSPRHNC---TEPEIC--------GCSKGYQLTDDG------CQPV------ 248
              |.:.::.|  |..|..:|   ::|.:.        .|..|......|      |.||      
 Worm   154 GSRCVAAANCPFGKLPGQSCVRKSDPSLAFNIPSNQDNCPMGQVCITAGESQVGHCCPVICPLNT 218

  Fly   249 -------CEPDCGIGGLC-KDNNQCDCAPGYNLRDG-VCQADCYQK-CN---------------- 287
                   |:||......| .|::.|     |.|.|| ..||.|.:: ||                
 Worm   219 TTDTRYSCDPDAAPALKCPSDSHYC-----YFLSDGSFSQAACCRRPCNAMAPNALYVDYHCMPR 278

  Fly   288 ---NGVCVSRNRC 297
               |..|.|..:|
 Worm   279 GQLNSACTSNAQC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
F56B3.2NP_499983.2 EB 111..157 CDD:279949 5/45 (11%)
EB 266..312 CDD:279949 4/26 (15%)
EB 332..383 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.